FGF19 (NM_005117) Human Mass Spec Standard
CAT#: PH303750
FGF19 MS Standard C13 and N15-labeled recombinant protein (NP_005108)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203750 |
Predicted MW | 24 kDa |
Protein Sequence |
>RC203750 protein sequence
Red=Cloning site Green=Tags(s) MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDC ARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHR LPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVR SPSFEK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005108 |
RefSeq Size | 2157 |
RefSeq ORF | 648 |
Locus ID | 9965 |
UniProt ID | O95750 |
Cytogenetics | 11q13.3 |
Summary | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This growth factor is a high affinity, heparin dependent ligand for FGFR4. Expression of this gene was detected only in fetal but not adult brain tissue. Synergistic interaction of the chick homolog and Wnt-8c has been shown to be required for initiation of inner ear development. [provided by RefSeq, Jul 2008] |
Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane |
Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417507 | FGF19 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417507 | Transient overexpression lysate of fibroblast growth factor 19 (FGF19) |
USD 436.00 |
|
TP303750 | Recombinant protein of human fibroblast growth factor 19 (FGF19), 20 µg |
USD 867.00 |
|
TP721009 | Purified recombinant protein of Human fibroblast growth factor 19 (FGF19) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review