OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRTFDC1 (NM_020200) Human Mass Spec Standard

Be the first to review this product
SKU
PH303702
PRTFDC1 MS Standard C13 and N15-labeled recombinant protein (NP_064585)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY412622 Transient overexpression lysate of phosphoribosyl transferase domain containing 1 (PRTFDC1) (as WB positive control) 100 ug
$436.00

Other products for "PRTFDC1 or NM_020200"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203702
Predicted MW 25.7 kDa
Protein Sequence
Protein Sequence
>RC203702 protein sequence
Red=Cloning site Green=Tags(s)

MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIM
VLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIV
EDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLN
HICVINEHGKEKYRV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_064585
RefSeq Size 2002
RefSeq ORF 675
Synonyms HHGP
Locus ID 56952
UniProt ID Q9NRG1
Cytogenetics 10p12.1
Summary Has low, barely detectable phosphoribosyltransferase activity (in vitro). Binds GMP, IMP and alpha-D-5-phosphoribosyl 1-pyrophosphate (PRPP). Is not expected to contribute to purine metabolism or GMP salvage.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRTFDC1" proteins (3)
SKU Description Size Price
LC412622 Lyophilized PRTFDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412622 Transient overexpression lysate of phosphoribosyl transferase domain containing 1 (PRTFDC1) (as WB positive control) 100 ug
$436.00
TP303702 Recombinant protein of human phosphoribosyl transferase domain containing 1 (PRTFDC1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products