PRTFDC1 (NM_020200) Human Mass Spec Standard

CAT#: PH303702

PRTFDC1 MS Standard C13 and N15-labeled recombinant protein (NP_064585)

Product Images

Coomassie blue staining of purified PRTFDC1 protein (Cat# TP303702). The protein was produced from HEK293T cells transfected with PRTFDC1 cDNA clone (Cat# RC203702) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203702
• Predicted MW: 25.7 kDa
• Protein Sequence:
  Sequence Link

  >RC203702 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIM
  VLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIV
  EDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLN
  HICVINEHGKEKYRV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_064585
• RefSeq Size: 2002
• RefSeq ORF: 675
• Synonyms: HHGP
• Locus ID: 56952
• UniProt ID: Q9NRG1
• Cytogenetics: 10p12.1
• Summary: Has low, barely detectable phosphoribosyltransferase activity (in vitro). Binds GMP, IMP and alpha-D-5-phosphoribosyl 1-pyrophosphate (PRPP). Is not expected to contribute to purine metabolism or GMP salvage.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome