OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ECHDC3 (NM_024693) Human Mass Spec Standard

Be the first to review this product
SKU
PH303685
ECHDC3 MS Standard C13 and N15-labeled recombinant protein (NP_078969)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA346830 Rabbit Polyclonal Anti-ECHDC3 Antibody
100 ul
$525.00
LY411153 Transient overexpression lysate of enoyl Coenzyme A hydratase domain containing 3 (ECHDC3), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00

Other products for "ECHDC3 or NM_024693"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203685
Predicted MW 32.7 kDa
Protein Sequence
Protein Sequence
>RC203685 protein sequence
Red=Cloning site Green=Tags(s)

MAAVAVLRAFGASGPMCLRRGPWAQLPARFCSRDPAGAGRRESEPRPTSARQLDGIRNIVLSNPKKRNTL
SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDYHAEVFQTCSKVMMHIRNHPV
PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVALARAVPRKVALEMLFTGEPIS
AQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQLPQDLGTAYYLTSQAMVDNLAL
RDGQEGITAFLQKRKPVWSHEPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078969
RefSeq Size 1674
RefSeq ORF 909
Locus ID 79746
UniProt ID Q96DC8
Cytogenetics 10p14
Summary May play a role in fatty acid biosynthesis and insulin sensitivity.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ECHDC3" proteins (3)
SKU Description Size Price
LC411153 Lyophilized ECHDC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411153 Transient overexpression lysate of enoyl Coenzyme A hydratase domain containing 3 (ECHDC3), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP303685 Recombinant protein of human enoyl Coenzyme A hydratase domain containing 3 (ECHDC3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products