OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC28B (NM_024296) Human Mass Spec Standard

Be the first to review this product
SKU
PH303631
CCDC28B MS Standard C13 and N15-labeled recombinant protein (NP_077272)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331747 Rabbit Polyclonal Anti-CCDC28B Antibody
100 ul
$585.00
LY411317 Transient overexpression lysate of coiled-coil domain containing 28B (CCDC28B) (as WB positive control) 100 ug
$436.00

Other products for "CCDC28B or NM_024296"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203631
Predicted MW 22 kDa
Protein Sequence
Protein Sequence
>RC203631 protein sequence
Red=Cloning site Green=Tags(s)

MDDKKKKRSPKPCLAQPAQAPGTLRRVPVPTSHSGSLALGLPHLPSPKQRAKFKRVGKEKCRPVLAGGGS
GSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCG
EEEDDEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEEQSAA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077272
RefSeq Size 1110
RefSeq ORF 600
Locus ID 79140
UniProt ID Q9BUN5
Cytogenetics 1p35.2
Summary The product of this gene localizes to centrosomes and basal bodies. The protein colocalizes with several proteins associated with Bardet-Biedl syndrome (BBS) and participates in the regulation of cilia development. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCDC28B" proteins (3)
SKU Description Size Price
LC411317 Lyophilized CCDC28B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411317 Transient overexpression lysate of coiled-coil domain containing 28B (CCDC28B) (as WB positive control) 100 ug
$436.00
TP303631 Recombinant protein of human coiled-coil domain containing 28B (CCDC28B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products