OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BSCL2 (NM_032667) Human Mass Spec Standard

Be the first to review this product
SKU
PH303625
BSCL2 MS Standard C13 and N15-labeled recombinant protein (NP_116056)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY403190 Transient overexpression lysate of Berardinelli-Seip congenital lipodystrophy 2 (seipin) (BSCL2), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "BSCL2 or NM_032667"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203625
Predicted MW 44.2 kDa
Protein Sequence
Protein Sequence
>RC203625 representing NM_032667
Red=Cloning site Green=Tags(s)

MVNDPPVPALLWAQEVGQVLAGRARRLLLQFGVLFCTILLLLWVSVFLYGSFYYSYMPTVSHLSPVHFYY
RTDCDSSTTSLCSFPVANVSLTKGGRDRVLMYGQPYRVTLELELPESPVNQDLGMFLVTISCYTRGGRII
STSSRSVMLHYRSDLLQMLDTLVFSSLLLFGFAEQKQLLEVELYADYRENSYVPTTGAIIEIHSKRIQLY
GAYLRIHAHFTGLRYLLYNFPMTCAFIGVASNFTFLSVIVLFSYMQWVWGGIWPRHRFSLQVNIRKRDNS
RKEVQRRISAHQPGAGPEGQEESTPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDG
SGSWEDAALLTEANLPAPAPASASAPVLETLGSSEPAGGALRQRPTCSSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116056
RefSeq Size 1664
RefSeq ORF 1200
Synonyms GNG3LG; HMN5; HMN5C; PELD; SPG17
Locus ID 26580
UniProt ID Q96G97
Cytogenetics 11q12.3
Summary This gene encodes the multi-pass transmembrane protein protein seipin. This protein localizes to the endoplasmic reticulum and may be important for lipid droplet morphology. Mutations in this gene have been associated with congenital generalized lipodystrophy type 2 or Berardinelli-Seip syndrome, a rare autosomal recessive disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HNRNPUL2 (heterogeneous nuclear ribonucleoprotein U-like 2).provided by RefSeq, Mar 2011
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BSCL2" proteins (3)
SKU Description Size Price
LC403190 Lyophilized BSCL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403190 Transient overexpression lysate of Berardinelli-Seip congenital lipodystrophy 2 (seipin) (BSCL2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303625 Recombinant protein of human Bernardinelli-Seip congenital lipodystrophy 2 (seipin) (BSCL2), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products