OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PELO (NM_015946) Human Mass Spec Standard

Be the first to review this product
SKU
PH303592
PELO MS Standard C13 and N15-labeled recombinant protein (NP_057030)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY414299 Transient overexpression lysate of pelota homolog (Drosophila) (PELO) (as WB positive control) 100 ug
$436.00

Other products for "PELO or NM_015946"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203592
Predicted MW 43.4 kDa
Protein Sequence
Protein Sequence
>RC203592 protein sequence
Red=Cloning site Green=Tags(s)

MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVE
AIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAV
VMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASP
GFVREQFCDYMFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDD
FYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLH
VSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057030
RefSeq Size 2941
RefSeq ORF 1155
Synonyms CGI-17; PRO1770
Locus ID 53918
UniProt ID Q9BRX2
Cytogenetics 5q11.2
Summary This gene encodes a protein which contains a conserved nuclear localization signal. The encoded protein may have a role in spermatogenesis, cell cycle control, and in meiotic cell division. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PELO" proteins (3)
SKU Description Size Price
LC414299 Lyophilized PELO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414299 Transient overexpression lysate of pelota homolog (Drosophila) (PELO) (as WB positive control) 100 ug
$436.00
TP303592 Recombinant protein of human pelota homolog (Drosophila) (PELO), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products