OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SERBP1 (NM_015640) Human Mass Spec Standard

Be the first to review this product
SKU
PH303582
SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_056455)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA800707 SERBP1 mouse monoclonal antibody,clone OTI5G2 100 ul
$447.00
LY422718 Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SERBP1 or NM_015640"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203582
Predicted MW 42.4 kDa
Protein Sequence
Protein Sequence
>RC203582 protein sequence
Red=Cloning site Green=Tags(s)

MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQL
RKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEK
PLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSGLKHEDKR
GGSGSHNWGTVKDELTDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDEWKAIQNKDR
AKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPANDITSQLEINFGDLGRPGRGGRG
GRGGRGRGGRPNRGSRTDKSSASAPDVDDPEAFPALA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056455
RefSeq Size 6701
RefSeq ORF 1161
Synonyms CGI-55; CHD3IP; HABP4L; PAI-RBP1; PAIRBP1
Locus ID 26135
UniProt ID Q8NC51
Cytogenetics 1p31.3
Summary May play a role in the regulation of mRNA stability. Binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay. Seems to play a role in PML-nuclear bodies formation (PubMed:28695742).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SERBP1" proteins (13)
SKU Description Size Price
PH301092 SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018077) 10 ug
$3,360.00
PH304527 SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018078) 10 ug
$3,360.00
LC402455 Lyophilized SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422718 Lyophilized SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422719 Lyophilized SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422720 Lyophilized SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402455 Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY422718 Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422719 Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422720 Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP301092 Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 1, 20 µg 20 ug
$737.00
TP303582 Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 4, 20 µg 20 ug
$737.00
TP304527 Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products