SERBP1 (NM_001018068) Human Mass Spec Standard

SKU
PH304527
SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018078)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204527]
Predicted MW 44.3 kDa
Protein Sequence
Protein Sequence
>RC204527 protein sequence
Red=Cloning site Green=Tags(s)

MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQL
RKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEK
PLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSGLKHEDKR
GGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPK
EMTLDEWKAIQNKDRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPANDITSQLE
INFGDLGRPGRGGRGGRGGRGRGGRPNRGSRTDKSSASAPDVDDPEAFPALA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001018078
RefSeq Size 6746
RefSeq ORF 1206
Synonyms CGI-55; CHD3IP; HABP4L; PAI-RBP1; PAIRBP1
Locus ID 26135
UniProt ID Q8NC51
Cytogenetics 1p31.3
Summary May play a role in the regulation of mRNA stability. Binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay. Seems to play a role in PML-nuclear bodies formation (PubMed:28695742).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SERBP1 (NM_001018068) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301092 SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018077) 10 ug
$3,255.00
PH303582 SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_056455) 10 ug
$3,255.00
LC402455 SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422718 SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422719 SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422720 SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402455 Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 4 100 ug
$436.00
LY422718 Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 1 100 ug
$436.00
LY422719 Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 2 100 ug
$436.00
LY422720 Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 3 100 ug
$436.00
TP301092 Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 1, 20 µg 20 ug
$737.00
TP303582 Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 4, 20 µg 20 ug
$737.00
TP304527 Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.