OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ANKRD54 (NM_138797) Human Mass Spec Standard

Be the first to review this product
SKU
PH303528
ANKRD54 MS Standard C13 and N15-labeled recombinant protein (NP_620152)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA322070 Anti-ANKRD54 rabbit polyclonal antibody
100 ul
$305.00
LY408483 Transient overexpression lysate of ankyrin repeat domain 54 (ANKRD54) (as WB positive control) 100 ug
$436.00

Other products for "ANKRD54 or NM_138797"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203528
Predicted MW 32.5 kDa
Protein Sequence
Protein Sequence
>RC203528 protein sequence
Red=Cloning site Green=Tags(s)

MAAAAGDADDEPRSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGGAGLSGRASGGAQSPLRYLHV
LWQQDAEPRDELRCKIPAGRLRRAARPHRRLGPTGKEVHALKRLRDSANANDVETVQQLLEDGADPCAAD
DKGRTALHFASCNGNDQIVQLLLDHGADPNQRDGLGNTPLHLAACTNHVPVITTLLRGGARVDALDRAGR
TPLHLAKSKLNILQEGHAQCLEAVRLEVKQIIHMLREYLERLGQHEQRERLDDLCTRLQMTSTKEQVDEV
TDLLASFTSLSLQMQSMEKR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620152
RefSeq Size 2149
RefSeq ORF 900
Synonyms LIAR
Locus ID 129138
UniProt ID Q6NXT1
Cytogenetics 22q13.1
Summary Plays an important role in regulating intracellular signaling events associated with erythroid terminal differentiation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ANKRD54" proteins (3)
SKU Description Size Price
LC408483 Lyophilized ANKRD54 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408483 Transient overexpression lysate of ankyrin repeat domain 54 (ANKRD54) (as WB positive control) 100 ug
$436.00
TP303528 Recombinant protein of human ankyrin repeat domain 54 (ANKRD54), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products