SDSL (NM_138432) Human Mass Spec Standard

CAT#: PH303515

SDSL MS Standard C13 and N15-labeled recombinant protein (NP_612441)

Product Images

Coomassie blue staining of purified SDSL protein (Cat# TP303515). The protein was produced from HEK293T cells transfected with SDSL cDNA clone (Cat# RC203515) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203515
• Predicted MW: 34.7 kDa
• Protein Sequence:
  Sequence Link

  >RC203515 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDGPVAEHAKQEPFHVVTPLLESWALSQVAGMPVFLKCENVQPSGSFKIRGIGHFCQEMAKKGCRHLVCS
  SGGNAGIAAAYAARKLGIPATIVLPESTSLQVVQRLQGEGAEVQLTGKVWDEANLRAQELAKRDGWENVP
  PFDHPLIWKGHASLVQELKAVLRTPPGALVLAVGGGGLLAGVVAGLLEVGWQHVPIIAMETHGAHCFNAA
  ITAGKLVTLPDITSVAKSLGAKTVAARALECMQVCKIHSEVVEDTEAVSAVQQLLDDERMLVEPACGAAL
  AAIYSGLLRRLQAEGCLPPSLTSVVVIVCGGNNINSRELQALKTHLGQV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_612441
• RefSeq Size: 1414
• RefSeq ORF: 987
• Synonyms: cSDH; SDH 2; SDS-RS1; TDH
• Locus ID: 113675
• UniProt ID: Q96GA7, A0A024RBL2
• Cytogenetics: 12q24.13
• Summary: Has low serine dehydratase and threonine dehydratase activity.[UniProtKB/Swiss-Prot Function]