OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ANKRD40 (NM_052855) Human Mass Spec Standard

Be the first to review this product
SKU
PH303512
ANKRD40 MS Standard C13 and N15-labeled recombinant protein (NP_443087)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA333573 Rabbit Polyclonal Anti-ANKRD40 Antibody
100 ul
$585.00
LY409432 Transient overexpression lysate of ankyrin repeat domain 40 (ANKRD40) (as WB positive control) 100 ug
$436.00

Other products for "ANKRD40 or NM_052855"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203512
Predicted MW 41.1 kDa
Protein Sequence
Protein Sequence
>RC203512 protein sequence
Red=Cloning site Green=Tags(s)

MNALLEQKEQQERLREAAALGDIREVQKLVESGVDVNSQNEVNGWTCLHWACKRNHGQVVSYLLKSGADK
EILTTKGEMPVQLTSRREIRKIMGVEEEDDDDDDDDNLPQLKKESELPFVPNYLANPAFPFIYTPTAEDS
AQMQNGGPSTPPASPPADGSPPLLPPGEPPLLGTFPRDHTSLALVQNGDVSAPSAILRTPESTKPGPVCQ
PPVSQSRSLFSSVPSKPPMSLEPQNGTYAGPAPAFQPFFFTGAFPFNMQELVLKVRIQNPSLRENDFIEI
ELDRQELTYQELLRVCCCELGVNPDQVEKIRKLPNTLLRKDKDVARLQDFQELELVLMISENNFLFRNAA
STLTERPCYNRRASKLTY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443087
RefSeq Size 4169
RefSeq ORF 1104
Locus ID 91369
UniProt ID Q6AI12
Cytogenetics 17q21.33
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ANKRD40" proteins (3)
SKU Description Size Price
LC409432 Lyophilized ANKRD40 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409432 Transient overexpression lysate of ankyrin repeat domain 40 (ANKRD40) (as WB positive control) 100 ug
$436.00
TP303512 Recombinant protein of human ankyrin repeat domain 40 (ANKRD40), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products