OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SCRN2 (NM_138355) Human Mass Spec Standard

Be the first to review this product
SKU
PH303501
SCRN2 MS Standard C13 and N15-labeled recombinant protein (NP_612364)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA366022 SCRN2 rabbit polyclonal antibody
100 ul
$310.00
LY408627 Transient overexpression lysate of secernin 2 (SCRN2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SCRN2 or NM_138355"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203501
Predicted MW 46.6 kDa
Protein Sequence
Protein Sequence
>RC203501 protein sequence
Red=Cloning site Green=Tags(s)

MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGTHTPGSRLQCTYIEVEQVSKT
HAVILSRPSWLWGAEMGANEHGVCIGNEAVWTKEPVGEGEALLGMDLLRLALERSSSAQEALHVITGLLE
HYGQGGNCLEDAAPFSYHSTFLLADRTEAWVLETAGRLWAAQRIQEGARNISNQLSIGTDISAQHPELRT
HAQAKGWWDGQGAFDFAQIFSLTQQPVRMEAAKARFQAGRELLRQRQGGITAEVMMGILRDKESGICMDS
GGFRTTASMVSVLPQDPTQPCVHFLTATPDPSRSVFKPFIFGVGVAQAPQVLSPTFGAQDPVRTLPRFQT
QVDRRHTLYRGHQAALGLMERDQDRGQQLQQKQQDLEQEGLEATQGLLAGEWAPPLWELGSLFQAFVKRE
SQAYA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612364
RefSeq Size 1582
RefSeq ORF 1275
Synonyms Ses2
Locus ID 90507
UniProt ID Q96FV2
Cytogenetics 17q21.32
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SCRN2" proteins (5)
SKU Description Size Price
LC408627 Lyophilized SCRN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428647 Lyophilized SCRN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408627 Transient overexpression lysate of secernin 2 (SCRN2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428647 Transient overexpression lysate of secernin 2 (SCRN2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303501 Recombinant protein of human secernin 2 (SCRN2), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products