OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FHL1 (NM_001449) Human Mass Spec Standard

Be the first to review this product
SKU
PH303478
FHL1 MS Standard C13 and N15-labeled recombinant protein (NP_001440)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY400563 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "FHL1 or NM_001449"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203478
Predicted MW 31.7 kDa
Protein Sequence
Protein Sequence
>RC203478 representing NM_001449
Red=Cloning site Green=Tags(s)

MAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYKNRFWHDTCFRCAK
CLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGS
FFPKGEDFYCVTCHETKFAKHCVKCNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCV
DCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCSVNLANKRFVFHQEQVYCPDCAKKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001440
RefSeq Size 2398
RefSeq ORF 840
Synonyms FCMSU; FHL-1; FHL1A; FHL1B; FLH1A; KYOT; RBMX1A; RBMX1B; SLIM; SLIM-1; SLIM1; SLIMMER; XMPMA
Locus ID 2273
UniProt ID Q13642
Cytogenetics Xq26.3
Summary This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. Expression of these family members occurs in a cell- and tissue-specific mode and these proteins are involved in many cellular processes. Mutations in this gene have been found in patients with Emery-Dreifuss muscular dystrophy. Multiple alternately spliced transcript variants which encode different protein isoforms have been described.provided by RefSeq, Nov 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FHL1" proteins (17)
SKU Description Size Price
LC400563 Lyophilized FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431153 Lyophilized FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431271 Lyophilized FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431283 Lyophilized FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431827 Lyophilized FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431828 Lyophilized FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400563 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY431153 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 6 (as WB positive control) 100 ug
$436.00
LY431271 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY431283 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431827 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY431828 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP303478 Recombinant protein of human four and a half LIM domains 1 (FHL1), 20 µg 20 ug
$737.00
TP328125 Purified recombinant protein of Homo sapiens four and a half LIM domains 1 (FHL1), transcript variant 6, 20 µg 20 ug
$737.00
TP328243 Purified recombinant protein of Homo sapiens four and a half LIM domains 1 (FHL1), transcript variant 5, 20 µg 20 ug
$737.00
TP328799 Recombinant protein of human four and a half LIM domains 1 (FHL1), transcript variant 3, 20 µg 20 ug
$737.00
TP328800 Recombinant protein of human four and a half LIM domains 1 (FHL1), transcript variant 4, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products