FHL1 (NM_001449) Human Recombinant Protein

SKU
TP303478
Recombinant protein of human four and a half LIM domains 1 (FHL1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203478 representing NM_001449
Red=Cloning site Green=Tags(s)

MAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYKNRFWHDTCFRCAK
CLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGS
FFPKGEDFYCVTCHETKFAKHCVKCNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCV
DCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCSVNLANKRFVFHQEQVYCPDCAKKL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 31.7 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Enzyme substrate (PMID: 26551678)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001440
Locus ID 2273
UniProt ID Q13642
Cytogenetics Xq26.3
RefSeq Size 2398
RefSeq ORF 840
Synonyms FCMSU; FHL-1; FHL1A; FHL1B; FLH1A; KYOT; RBMX1A; RBMX1B; SLIM; SLIM-1; SLIM1; SLIMMER; XMPMA
Summary This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. Expression of these family members occurs in a cell- and tissue-specific mode and these proteins are involved in many cellular processes. Mutations in this gene have been found in patients with Emery-Dreifuss muscular dystrophy. Multiple alternately spliced transcript variants which encode different protein isoforms have been described.[provided by RefSeq, Nov 2009]
Write Your Own Review
You're reviewing:FHL1 (NM_001449) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303478 FHL1 MS Standard C13 and N15-labeled recombinant protein (NP_001440) 10 ug
$3,255.00
LC400563 FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431153 FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431271 FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431283 FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431827 FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431828 FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400563 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 2 100 ug
$436.00
LY431153 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 6 100 ug
$436.00
LY431271 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 5 100 ug
$436.00
LY431283 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 1 100 ug
$436.00
LY431827 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 3 100 ug
$436.00
LY431828 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 4 100 ug
$436.00
TP328125 Purified recombinant protein of Homo sapiens four and a half LIM domains 1 (FHL1), transcript variant 6, 20 µg 20 ug
$737.00
TP328243 Purified recombinant protein of Homo sapiens four and a half LIM domains 1 (FHL1), transcript variant 5, 20 µg 20 ug
$737.00
TP328799 Recombinant protein of human four and a half LIM domains 1 (FHL1), transcript variant 3, 20 µg 20 ug
$737.00
TP328800 Recombinant protein of human four and a half LIM domains 1 (FHL1), transcript variant 4, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.