FHL1 (NM_001449) Human Mass Spec Standard

SKU
PH303478
FHL1 MS Standard C13 and N15-labeled recombinant protein (NP_001440)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203478]
Predicted MW 31.7 kDa
Protein Sequence
Protein Sequence
>RC203478 representing NM_001449
Red=Cloning site Green=Tags(s)

MAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYKNRFWHDTCFRCAK
CLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGS
FFPKGEDFYCVTCHETKFAKHCVKCNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCV
DCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCSVNLANKRFVFHQEQVYCPDCAKKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001440
RefSeq Size 2398
RefSeq ORF 840
Synonyms FCMSU; FHL-1; FHL1A; FHL1B; FLH1A; KYOT; RBMX1A; RBMX1B; SLIM; SLIM-1; SLIM1; SLIMMER; XMPMA
Locus ID 2273
UniProt ID Q13642
Cytogenetics Xq26.3
Summary This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. Expression of these family members occurs in a cell- and tissue-specific mode and these proteins are involved in many cellular processes. Mutations in this gene have been found in patients with Emery-Dreifuss muscular dystrophy. Multiple alternately spliced transcript variants which encode different protein isoforms have been described.[provided by RefSeq, Nov 2009]
Write Your Own Review
You're reviewing:FHL1 (NM_001449) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400563 FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431153 FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431271 FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431283 FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431827 FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431828 FHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400563 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 2 100 ug
$436.00
LY431153 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 6 100 ug
$436.00
LY431271 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 5 100 ug
$436.00
LY431283 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 1 100 ug
$436.00
LY431827 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 3 100 ug
$436.00
LY431828 Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 4 100 ug
$436.00
TP303478 Recombinant protein of human four and a half LIM domains 1 (FHL1), 20 µg 20 ug
$737.00
TP328125 Purified recombinant protein of Homo sapiens four and a half LIM domains 1 (FHL1), transcript variant 6, 20 µg 20 ug
$737.00
TP328243 Purified recombinant protein of Homo sapiens four and a half LIM domains 1 (FHL1), transcript variant 5, 20 µg 20 ug
$737.00
TP328799 Recombinant protein of human four and a half LIM domains 1 (FHL1), transcript variant 3, 20 µg 20 ug
$737.00
TP328800 Recombinant protein of human four and a half LIM domains 1 (FHL1), transcript variant 4, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.