FHL1 (NM_001449) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC203478] |
Predicted MW | 31.7 kDa |
Protein Sequence |
Protein Sequence
>RC203478 representing NM_001449
Red=Cloning site Green=Tags(s) MAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYKNRFWHDTCFRCAK CLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGS FFPKGEDFYCVTCHETKFAKHCVKCNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCV DCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCSVNLANKRFVFHQEQVYCPDCAKKL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001440 |
RefSeq Size | 2398 |
RefSeq ORF | 840 |
Synonyms | FCMSU; FHL-1; FHL1A; FHL1B; FLH1A; KYOT; RBMX1A; RBMX1B; SLIM; SLIM-1; SLIM1; SLIMMER; XMPMA |
Locus ID | 2273 |
UniProt ID | Q13642 |
Cytogenetics | Xq26.3 |
Summary | This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. Expression of these family members occurs in a cell- and tissue-specific mode and these proteins are involved in many cellular processes. Mutations in this gene have been found in patients with Emery-Dreifuss muscular dystrophy. Multiple alternately spliced transcript variants which encode different protein isoforms have been described.[provided by RefSeq, Nov 2009] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC400563 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431153 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431271 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431283 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431827 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431828 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400563 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 2 | 100 ug |
$436.00
|
|
LY431153 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 6 | 100 ug |
$436.00
|
|
LY431271 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 5 | 100 ug |
$436.00
|
|
LY431283 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 1 | 100 ug |
$436.00
|
|
LY431827 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 3 | 100 ug |
$436.00
|
|
LY431828 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 4 | 100 ug |
$436.00
|
|
TP303478 | Recombinant protein of human four and a half LIM domains 1 (FHL1), 20 µg | 20 ug |
$737.00
|
|
TP328125 | Purified recombinant protein of Homo sapiens four and a half LIM domains 1 (FHL1), transcript variant 6, 20 µg | 20 ug |
$737.00
|
|
TP328243 | Purified recombinant protein of Homo sapiens four and a half LIM domains 1 (FHL1), transcript variant 5, 20 µg | 20 ug |
$737.00
|
|
TP328799 | Recombinant protein of human four and a half LIM domains 1 (FHL1), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
TP328800 | Recombinant protein of human four and a half LIM domains 1 (FHL1), transcript variant 4, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.