OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NUDT6 (NM_007083) Human Mass Spec Standard

Be the first to review this product
SKU
PH303470
NUDT6 MS Standard C13 and N15-labeled recombinant protein (NP_009014)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502343 NUDT6 mouse monoclonal antibody, clone OTI9D12 (formerly 9D12) 100 ul
$447.00
LY402086 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "NUDT6 or NM_007083"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203470
Predicted MW 35.7 kDa
Protein Sequence
Protein Sequence
>RC203470 protein sequence
Red=Cloning site Green=Tags(s)

MRQPLSWGRWRAMLARTYGPGPSAGYRWASGAQGYVRNPPVGACDLQGELDRFGGISVRLARLDALDRLD
AAAFQKGLQAAVQQWRSEGRTAVWLHIPILQSRFIAPAASLGFCFHHAESDSSTLTLWLREGPSRLPGYA
SHQVGVAGAVFDESTRKILVVQDRNKLKNMWKFPGGLSEPEEDIGDTAVREVFEETGIKSEFRSVLSIRQ
QHTNPGAFGKSDMYIICRLKPYSFTINFCQEECLRCEWMDLNDLAKTENTTPITSRVARLLLYGYREGFD
KIDLTVEELPAVYTGLFYKLYHKELPENYKTMKGID

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009014
RefSeq Size 1197
RefSeq ORF 948
Synonyms ASFGF2; FGF-AS; FGF2AS; GFG-1; GFG1
Locus ID 11162
UniProt ID P53370
Cytogenetics 4q28.1
Summary This gene overlaps and lies on the opposite strand from FGF2 gene, and is thought to be the FGF2 antisense gene. The two genes are independently transcribed, and their expression shows an inverse relationship, suggesting that this antisense transcript may regulate FGF2 expression. This gene has also been shown to have hormone-regulatory and antiproliferative actions in the pituitary that are independent of FGF2 expression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Oct 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NUDT6" proteins (6)
SKU Description Size Price
LC402086 Lyophilized NUDT6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405102 Lyophilized NUDT6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402086 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY405102 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303470 Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 1, 20 µg 20 ug
$867.00
TP760249 Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products