OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Apg3 (ATG3) (NM_022488) Human Mass Spec Standard

Be the first to review this product
SKU
PH303453
ATG3 MS Standard C13 and N15-labeled recombinant protein (NP_071933)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503161 ATG3 mouse monoclonal antibody, clone OTI2C12 (formerly 2C12) 100 ul
$447.00
LY411559 Transient overexpression lysate of ATG3 autophagy related 3 homolog (S. cerevisiae) (ATG3) (as WB positive control) 100 ug
$436.00

Other products for "Apg3 or NM_022488"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203453
Predicted MW 35.9 kDa
Protein Sequence
Protein Sequence
>RC203453 protein sequence
Red=Cloning site Green=Tags(s)

MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTG
KQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCS
ALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYY
QTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEG
GGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071933
RefSeq Size 1572
RefSeq ORF 942
Synonyms APG3; APG3-LIKE; APG3L; PC3-96
Locus ID 64422
UniProt ID Q9NT62
Cytogenetics 3q13.2
Summary This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Jul 2013
Protein Pathways Regulation of autophagy
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Apg3" proteins (4)
SKU Description Size Price
LC411559 Lyophilized ATG3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411559 Transient overexpression lysate of ATG3 autophagy related 3 homolog (S. cerevisiae) (ATG3) (as WB positive control) 100 ug
$436.00
TP303453 Recombinant protein of human ATG3 autophagy related 3 homolog (S. cerevisiae) (ATG3), 20 µg 20 ug
$867.00
TP720530 Recombinant protein of human ATG3 autophagy related 3 homolog (S. cerevisiae) (ATG3) 10 ug
$160.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products