Apg3 (ATG3) (NM_022488) Human Recombinant Protein

SKU
TP303453
Recombinant protein of human ATG3 autophagy related 3 homolog (S. cerevisiae) (ATG3), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203453 protein sequence
Red=Cloning site Green=Tags(s)

MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTG
KQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCS
ALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYY
QTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEG
GGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_071933
Locus ID 64422
UniProt ID Q9NT62
Cytogenetics 3q13.2
RefSeq Size 1572
RefSeq ORF 942
Synonyms APG3; APG3-LIKE; APG3L; PC3-96
Summary This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]
Protein Pathways Regulation of autophagy
Write Your Own Review
You're reviewing:Apg3 (ATG3) (NM_022488) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303453 ATG3 MS Standard C13 and N15-labeled recombinant protein (NP_071933) 10 ug
$3,255.00
LC411559 ATG3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411559 Transient overexpression lysate of ATG3 autophagy related 3 homolog (S. cerevisiae) (ATG3) 100 ug
$436.00
TP720530 Recombinant protein of human ATG3 autophagy related 3 homolog (S. cerevisiae) (ATG3) 10 ug
$155.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.