Apg3 (ATG3) (NM_022488) Human Mass Spec Standard

SKU
PH303453
ATG3 MS Standard C13 and N15-labeled recombinant protein (NP_071933)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203453]
Predicted MW 35.9 kDa
Protein Sequence
Protein Sequence
>RC203453 protein sequence
Red=Cloning site Green=Tags(s)

MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTG
KQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCS
ALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYY
QTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEG
GGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071933
RefSeq Size 1572
RefSeq ORF 942
Synonyms APG3; APG3-LIKE; APG3L; PC3-96
Locus ID 64422
UniProt ID Q9NT62
Cytogenetics 3q13.2
Summary This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]
Protein Pathways Regulation of autophagy
Write Your Own Review
You're reviewing:Apg3 (ATG3) (NM_022488) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411559 ATG3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411559 Transient overexpression lysate of ATG3 autophagy related 3 homolog (S. cerevisiae) (ATG3) 100 ug
$436.00
TP303453 Recombinant protein of human ATG3 autophagy related 3 homolog (S. cerevisiae) (ATG3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720530 Recombinant protein of human ATG3 autophagy related 3 homolog (S. cerevisiae) (ATG3) 10 ug
$155.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.