OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LASS4 (CERS4) (NM_024552) Human Mass Spec Standard

Be the first to review this product
SKU
PH303402
LASS4 MS Standard C13 and N15-labeled recombinant protein (NP_078828)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351343 Rabbit Polyclonal Anti-CERS4 Antibody
100 ul
$205.00
LY411226 Transient overexpression lysate of LAG1 homolog, ceramide synthase 4 (LASS4) (as WB positive control) 100 ug
$436.00

Other products for "LASS4 or NM_024552"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203402
Predicted MW 46.4 kDa
Protein Sequence
Protein Sequence
>RC203402 protein sequence
Red=Cloning site Green=Tags(s)

MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLLAMRLAFERFIGLPLSRWLGV
RDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWRF
LFYLSSFVGGLSVLYHESWLWAPVMCWDRYPNQTLKPSLYWWYLLELGFYLSLLIRLPFDVKRKDFKEQV
IHHFVAVILMTFSYSANLLRIGSLVLLLHDSSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLF
PTQILYTTYYESISNRGPFFGYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSS
EEVAAAQEPLQLKNGAAGGPRPAPTDGPQSRVAGRLTNRHTTAT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078828
RefSeq Size 1817
RefSeq ORF 1182
Synonyms LASS4; Trh1
Locus ID 79603
UniProt ID Q9HA82
Cytogenetics 19p13.2
Summary May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing different fatty acid donors (N-linked stearoyl- (C18) or arachidoyl- (C20) ceramides) in a fumonisin B1-independent manner (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Transcription Factors, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LASS4" proteins (3)
SKU Description Size Price
LC411226 Lyophilized CERS4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411226 Transient overexpression lysate of LAG1 homolog, ceramide synthase 4 (LASS4) (as WB positive control) 100 ug
$436.00
TP303402 Recombinant protein of human LAG1 homolog, ceramide synthase 4 (LASS4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products