TOE1 (NM_025077) Human Mass Spec Standard

CAT#: PH303377

TOE1 MS Standard C13 and N15-labeled recombinant protein (NP_079353)

Product Images

Coomassie blue staining of purified TOE1 protein (Cat# TP303377). The protein was produced from HEK293T cells transfected with TOE1 cDNA clone (Cat# RC203377) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203377
• Predicted MW: 56.5 kDa
• Protein Sequence:
  Sequence Link

  >RC203377 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAADSDDGAVSAPAASDGGVSKSTTSGEELVVQVPVVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGL
  GDRKSLLNQCIEERYKAVCHAARTRSILSLGLACFKRQPDKGEHSYLAQVFNLTLLCMEEYVIEPKSVQF
  LIQHGFNFNQQYAQGIPYHKGNDKGDESQSQSVRTLFLELIRARRPLVLHNGLIDLVFLYQNFYAHLPES
  LGTFTADLCEMFPAGIYDTKYAAEFHARFVASYLEYAFRKCERENGKQRAAGSPHLTLEFCNYPSSMRDH
  IDYRCCLPPATHRPHPTSICDNFSAYGWCPLGPQCPQSHDIDLIIDTDEAAAEDKRRRRRRREKRKRALL
  NLPGTQTSGEAKDGPPKKQVCGDSIKPEETEQEVAADETRNLPHSKQGNKNDLEMGIKAARPEIADRATS
  EVPGSQASPNPVPGDGLHRAGFDAFMTGYVMAYVEVSQGPQPCSSGPWLPECHNKVYLSGKAVPLTVAKS
  QFSRSSKAHNQKMKLTWGSS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079353
• RefSeq Size: 2408
• RefSeq ORF: 1530
• Synonyms: hCaf1z; PCH7
• Locus ID: 114034
• UniProt ID: Q96GM8
• Cytogenetics: 1p34.1
• Summary: Inhibits cell growth rate and cell cycle. Induces CDKN1A expression as well as TGF-beta expression. Mediates the inhibitory growth effect of EGR1. Involved in the maturation of snRNAs and snRNA 3'-tail processing (PubMed:28092684).[UniProtKB/Swiss-Prot Function]
• Protein Families: Stem cell - Pluripotency, Transcription Factors