OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Peroxiredoxin 4 (PRDX4) (NM_006406) Human Mass Spec Standard

Be the first to review this product
SKU
PH303330
PRDX4 MS Standard C13 and N15-labeled recombinant protein (NP_006397)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500684 PRDX4 (Peroxiredoxin 4) mouse monoclonal antibody, clone OTI9A3 (formerly 9A3) 100 ul
$447.00
LY401927 Transient overexpression lysate of peroxiredoxin 4 (PRDX4) (as WB positive control) 100 ug
$436.00

Other products for "Peroxiredoxin 4 or NM_006406"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203330
Predicted MW 30.5 kDa
Protein Sequence
Protein Sequence
>RC203330 protein sequence
Red=Cloning site Green=Tags(s)

MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVA
DHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRS
INTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGI
LRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006397
RefSeq Size 921
RefSeq ORF 813
Synonyms AOE37-2; AOE372; HEL-S-97n; PRX-4
Locus ID 10549
UniProt ID Q13162
Cytogenetics Xp22.11
Summary The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Peroxiredoxin 4" proteins (5)
SKU Description Size Price
LC401927 Lyophilized PRDX4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401927 Transient overexpression lysate of peroxiredoxin 4 (PRDX4) (as WB positive control) 100 ug
$436.00
TP303330 Recombinant protein of human peroxiredoxin 4 (PRDX4), 20 µg 20 ug
$867.00
TP720568 Recombinant protein of human peroxiredoxin 4 (PRDX4) 10 ug
$340.00
TP750204 Purified recombinant protein of Human peroxiredoxin 4 (PRDX4), full length, with C-terminal His tag, expressed in E.coli, 50ug 50 ug
$240.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products