Peroxiredoxin 4 (PRDX4) (NM_006406) Human Tagged ORF Clone

SKU
RC203330
PRDX4 (Myc-DDK-tagged)-Human peroxiredoxin 4 (PRDX4)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Peroxiredoxin 4
Synonyms AOE37-2; AOE372; HEL-S-97n; PRX-4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203330 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCGCTGCCGCTGCTAGCCGCGACAACTCCGGACCACGGCCGCCACCGAAGGCTGCTTCTGCTGC
CGCTACTGCTGTTCCTGCTGCCGGCTGGAGCTGTGCAGGGCTGGGAGACAGAGGAGAGGCCCCGGACTCG
CGAAGAGGAGTGCCACTTCTACGCGGGTGGACAAGTGTACCCGGGAGAGGCATCCCGGGTATCGGTCGCC
GACCACTCCCTGCACCTAAGCAAAGCGAAGATTTCCAAGCCAGCGCCCTACTGGGAAGGAACAGCTGTGA
TCGATGGAGAATTTAAGGAGCTGAAGTTAACTGATTATCGTGGGAAATACTTGGTTTTCTTCTTCTACCC
ACTTGATTTCACATTTGTGTGTCCAACTGAAATTATCGCTTTTGGCGACAGACTTGAAGAATTCAGATCT
ATAAATACTGAAGTGGTAGCATGCTCTGTTGATTCACAGTTTACCCATTTGGCCTGGATTAATACCCCTC
GAAGACAAGGAGGACTTGGGCCAATAAGGATTCCACTTCTTTCAGATTTGACCCATCAGATCTCAAAGGA
CTATGGTGTATACCTAGAGGACTCAGGCCACACTCTTAGAGGTCTCTTCATTATTGATGACAAAGGAATC
CTAAGACAAATTACTCTGAATGATCTTCCTGTGGGTAGATCAGTGGATGAGACACTACGTTTGGTTCAAG
CATTCCAGTACACTGACAAACACGGAGAAGTCTGCCCTGCTGGCTGGAAACCTGGTAGTGAAACAATAAT
CCCAGATCCAGCTGGAAAGCTGAAGTATTTCGATAAACTGAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203330 protein sequence
Red=Cloning site Green=Tags(s)

MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVA
DHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRS
INTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGI
LRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006406
ORF Size 813 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006406.2
RefSeq Size 921 bp
RefSeq ORF 816 bp
Locus ID 10549
UniProt ID Q13162
Cytogenetics Xp22.11
Domains AhpC-TSA
Protein Families Druggable Genome
MW 30.5 kDa
Summary The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Peroxiredoxin 4 (PRDX4) (NM_006406) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203330L1 Lenti ORF clone of Human peroxiredoxin 4 (PRDX4), Myc-DDK-tagged 10 ug
$600.00
RC203330L2 Lenti ORF clone of Human peroxiredoxin 4 (PRDX4), mGFP tagged 10 ug
$600.00
RC203330L3 Lenti ORF clone of Human peroxiredoxin 4 (PRDX4), Myc-DDK-tagged 10 ug
$600.00
RC203330L4 Lenti ORF clone of Human peroxiredoxin 4 (PRDX4), mGFP tagged 10 ug
$600.00
RG203330 PRDX4 (tGFP-tagged) - Human peroxiredoxin 4 (PRDX4) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116095 PRDX4 (untagged)-Human peroxiredoxin 4 (PRDX4) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.