OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UBE2B (NM_003337) Human Mass Spec Standard

Be the first to review this product
SKU
PH303306
UBE2B MS Standard C13 and N15-labeled recombinant protein (NP_003328)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA803573 UBE2B mouse monoclonal antibody, clone OTI1E11 (formerly 1E11) 100 ul
$447.00
LY418755 Transient overexpression lysate of ubiquitin-conjugating enzyme E2B (RAD6 homolog) (UBE2B) (as WB positive control) 100 ug
$436.00

Other products for "UBE2B or NM_003337"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203306
Predicted MW 17.1 kDa
Protein Sequence
Protein Sequence
>RC203306 representing NM_003337
Red=Cloning site Green=Tags(s)

MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTV
RFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKR
VSAIVEQSWNDS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003328
RefSeq Size 2631
RefSeq ORF 456
Synonyms E2-17kDa; HHR6B; HR6B; RAD6B; UBC2
Locus ID 7320
UniProt ID P63146
Cytogenetics 5q31.1
Summary The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Its protein sequence is 100% identical to the mouse, rat, and rabbit homologs, which indicates that this enzyme is highly conserved in eukaryotic evolution. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UBE2B" proteins (5)
SKU Description Size Price
LC418755 Lyophilized UBE2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418755 Transient overexpression lysate of ubiquitin-conjugating enzyme E2B (RAD6 homolog) (UBE2B) (as WB positive control) 100 ug
$436.00
TP303306 Recombinant protein of human ubiquitin-conjugating enzyme E2B (RAD6 homolog) (UBE2B), 20 µg 20 ug
$867.00
TP720719 Purified recombinant protein of Human ubiquitin-conjugating enzyme E2B (UBE2B) 10 ug
$275.00
TP720915 Purified recombinant protein of Human ubiquitin-conjugating enzyme E2B (UBE2B) 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products