APIP (NM_015957) Human Mass Spec Standard

SKU
PH303297
APIP MS Standard C13 and N15-labeled recombinant protein (NP_057041)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203297]
Predicted MW 27.1 kDa
Protein Sequence
Protein Sequence
>RC203297 protein sequence
Red=Cloning site Green=Tags(s)

MSGCDAREGDCCSRRCGAQDKERPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAPSGVQKERIQP
EDMFVCDINEKDISGPSPSKKLKKSQCTPLFMNAYTMRGAGAVIHTHSKAAVMATLLFPGREFKITHQEM
IKGIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAVNEYPDSCAVLVRRHGVYVWGETWEKAKTM
CECYDYLFDIAVSMKKVGLDPSQLPVGENGIV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057041
RefSeq Size 1285
RefSeq ORF 726
Synonyms APIP2; CGI-29; CGI29; hAPIP; MMRP19
Locus ID 51074
UniProt ID Q96GX9
Cytogenetics 11p13
Summary APIP is an APAF1 (MIM 602233)-interacting protein that acts as a negative regulator of ischemic/hypoxic injury (Cho et al., 2004 [PubMed 15262985]).[supplied by OMIM, Dec 2008]
Protein Pathways Cysteine and methionine metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:APIP (NM_015957) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414309 APIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414309 Transient overexpression lysate of APAF1 interacting protein (APIP) 100 ug
$436.00
TP303297 Recombinant protein of human APAF1 interacting protein (APIP), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.