OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

APIP (NM_015957) Human Mass Spec Standard

Be the first to review this product
SKU
PH303297
APIP MS Standard C13 and N15-labeled recombinant protein (NP_057041)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA336411 Mouse Monoclonal APIP Antibody (19F461)
100 ug
$585.00
LY414309 Transient overexpression lysate of APAF1 interacting protein (APIP) (as WB positive control) 100 ug
$436.00

Other products for "APIP or NM_015957"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203297
Predicted MW 27.1 kDa
Protein Sequence
Protein Sequence
>RC203297 protein sequence
Red=Cloning site Green=Tags(s)

MSGCDAREGDCCSRRCGAQDKERPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAPSGVQKERIQP
EDMFVCDINEKDISGPSPSKKLKKSQCTPLFMNAYTMRGAGAVIHTHSKAAVMATLLFPGREFKITHQEM
IKGIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAVNEYPDSCAVLVRRHGVYVWGETWEKAKTM
CECYDYLFDIAVSMKKVGLDPSQLPVGENGIV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057041
RefSeq Size 1285
RefSeq ORF 726
Synonyms APIP2; CGI-29; CGI29; hAPIP; MMRP19
Locus ID 51074
UniProt ID Q96GX9
Cytogenetics 11p13
Summary APIP is an APAF1 (MIM 602233)-interacting protein that acts as a negative regulator of ischemic/hypoxic injury (Cho et al., 2004 PubMed 15262985).supplied by OMIM, Dec 2008
Protein Pathways Cysteine and methionine metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "APIP" proteins (3)
SKU Description Size Price
LC414309 Lyophilized APIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414309 Transient overexpression lysate of APAF1 interacting protein (APIP) (as WB positive control) 100 ug
$436.00
TP303297 Recombinant protein of human APAF1 interacting protein (APIP), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products