OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HSD17B2 (NM_002153) Human Mass Spec Standard

Be the first to review this product
SKU
PH303293
HSD17B2 MS Standard C13 and N15-labeled recombinant protein (NP_002144)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504565 HSD17B2 mouse monoclonal antibody, clone OTI4F10 (formerly 4F10) 100 ul
$447.00
LY419500 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 2 (HSD17B2) (as WB positive control) 100 ug
$436.00

Other products for "HSD17B2 or NM_002153"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203293
Predicted MW 42.8 kDa
Protein Sequence
Protein Sequence
>RC203293 protein sequence
Red=Cloning site Green=Tags(s)

MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYT
YLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDIT
KPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKS
KGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLE
KDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICL
AHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002144
RefSeq Size 1451
RefSeq ORF 1161
Synonyms EDH17B2; HSD17; SDR9C2
Locus ID 3294
UniProt ID P37059
Cytogenetics 16q23.3
Summary Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Transmembrane
Protein Pathways Androgen and estrogen metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HSD17B2" proteins (3)
SKU Description Size Price
LC419500 Lyophilized HSD17B2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419500 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 2 (HSD17B2) (as WB positive control) 100 ug
$436.00
TP303293 Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 2 (HSD17B2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products