ENY2 (NM_020189) Human Mass Spec Standard

CAT#: PH303231

ENY2 MS Standard C13 and N15-labeled recombinant protein (NP_064574)

Product Images

Coomassie blue staining of purified ENY2 protein (Cat# TP303231). The protein was produced from HEK293T cells transfected with ENY2 cDNA clone (Cat# RC203231) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203231
• Predicted MW: 11.5 kDa
• Protein Sequence:
  Sequence Link

  >RC203231 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAE
  ITPKGRALVPDSVKKELLQRIRTFLAQHASL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_064574
• RefSeq Size: 2948
• RefSeq ORF: 303
• Synonyms: DC6; e(y)2; Sus1
• Locus ID: 56943
• UniProt ID: Q9NPA8, A0A024R9D9
• Cytogenetics: 8q23.1
• Summary: Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation (PubMed:18206972, PubMed:21746879). As a component of the TREX-2 complex, involved in the export of mRNAs to the cytoplasm through the nuclear pores (PubMed:23591820).[UniProtKB/Swiss-Prot Function]