OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ABHD8 (NM_024527) Human Mass Spec Standard

Be the first to review this product
SKU
PH303206
ABHD8 MS Standard C13 and N15-labeled recombinant protein (NP_078803)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA315789 Rabbit polyclonal anti-ABHD8 antibody
100 ul
$380.00
LY411270 Transient overexpression lysate of abhydrolase domain containing 8 (ABHD8) (as WB positive control) 100 ug
$436.00

Other products for "ABHD8 or NM_024527"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203206
Predicted MW 47.3 kDa
Protein Sequence
Protein Sequence
>RC203206 protein sequence
Red=Cloning site Green=Tags(s)

MLTGVTDGIFCCLLGTPPNAVGPLESVESSDGYTFVEVKPGRVLRVKHAGPAPAAAPPPPSSASSDAAQG
DLSGLVRCQRRITVYRNGRLLVENLGRAPRADLLHGQNGSGEPPAALEVELADPAGSDGRLAPGSAGSGS
GSGSGGRRRRARRPKRTIHIDCEKRITSCKGAQADVVLFFIHGVGGSLAIWKEQLDFFVRLGYEVVAPDL
AGHGASSAPQVAAAYTFYALAEDMRAIFKRYAKKRNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGP
TALEPSFCSIFNMPTCVLHCLSPCLAWSFLKAGFARQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEG
DEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIDEGSHMVMLECPETVNTLLHEFLLWEP
EPSPKALPEPLPAPPEDKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078803
RefSeq Size 2114
RefSeq ORF 1317
Locus ID 79575
UniProt ID Q96I13
Cytogenetics 19p13.11
Summary This gene is upstream of, and in a head-to-head orientation with the gene for the mitochondrial ribosomal protein L34. The predicted protein contains alpha/beta hydrolase fold and secretory lipase domains. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ABHD8" proteins (3)
SKU Description Size Price
LC411270 Lyophilized ABHD8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411270 Transient overexpression lysate of abhydrolase domain containing 8 (ABHD8) (as WB positive control) 100 ug
$436.00
TP303206 Recombinant protein of human abhydrolase domain containing 8 (ABHD8), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products