OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EEF1D (NM_001960) Human Mass Spec Standard

Be the first to review this product
SKU
PH303202
EEF1D MS Standard C13 and N15-labeled recombinant protein (NP_001951)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811677 EEF1D mouse monoclonal antibody,clone OTI6B3 100 ul
$447.00
LY410171 Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "EEF1D or NM_001960"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203202
Predicted MW 71.4 kDa
Protein Sequence
Protein Sequence
>RC203202 protein sequence
Red=Cloning site Green=Tags(s)

MRSGKASCTLETVWEDKHKYEEAERRFYEHEATQAAASAQQLPAEGPAMNGPGQDDPEDADEAEAPDGGS
RRDPRKSQDSRKPLQKKRKRSPKSGLGPADLALLGLSAERVWLDKSLFDQAESSYRQKLADVAAQAAWPP
ALAPWGLCTHGNQVACHHVTWGIWVNKSSFDQAERAFVEWSQALLLAPEGSRRQGTPNTGQQVAVPDLAH
QPSPPVNGQPPLGSLQALVREVWLEKPRYDAAERGFYEALFDGHPPGKVRLQERAGLAEGARRGRRDRRG
RNILGNKRAGLRRADGEAPSALPYCYFLQKDAEAPWLSKPAYDSAECRHHAAEALRVAWCLEAASLSHRP
GPRSGLSVSSLRPNRKMATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVAGASRQENGASVILRDIARAR
ENIQKSLAGSSGPGASSGTSGDHGELVVRIASLEVENQSLRGVVQELQQAISKLEARLNVLEKSSPGHRA
TAPQTQHVSPMRQVEPPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVA
KSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEIT
KFEEHVQSVDIAAFNKI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001951
RefSeq Size 1276
RefSeq ORF 1941
Synonyms EF-1D; EF1D; FP1047
Locus ID 1936
UniProt ID P29692
Cytogenetics 8q24.3
Summary This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit, delta, functions as guanine nucleotide exchange factor. It is reported that following HIV-1 infection, this subunit interacts with HIV-1 Tat. This interaction results in repression of translation of host cell proteins and enhanced translation of viral proteins. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. Related pseudogenes have been defined on chromosomes 1, 6, 7, 9, 11, 13, 17, 19.provided by RefSeq, Aug 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EEF1D" proteins (14)
SKU Description Size Price
PH325386 EEF1D MS Standard C13 and N15-labeled recombinant protein (NP_001123527) 10 ug
$3,360.00
LC410171 Lyophilized EEF1D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419621 Lyophilized EEF1D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427131 Lyophilized EEF1D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427133 Lyophilized EEF1D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427135 Lyophilized EEF1D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410171 Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY419621 Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427131 Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY427133 Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY427135 Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 6 (as WB positive control) 100 ug
$436.00
TP303202 Recombinant protein of human eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 2, 20 µg 20 ug
$867.00
TP325386 Recombinant protein of human eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 5, 20 µg 20 ug
$867.00
TP760795 Purified recombinant protein of Human eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products