OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMEM126A (NM_032273) Human Mass Spec Standard

Be the first to review this product
SKU
PH303188
TMEM126A MS Standard C13 and N15-labeled recombinant protein (NP_115649)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY410221 Transient overexpression lysate of transmembrane protein 126A (TMEM126A) (as WB positive control) 100 ug
$436.00

Other products for "TMEM126A or NM_032273"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203188
Predicted MW 21.5 kDa
Protein Sequence
Protein Sequence
>RC203188 protein sequence
Red=Cloning site Green=Tags(s)

MENHKSNNKENITIVDISRKINQLPEAERNLLENGSVYVGLNAALCGLIANSLFRRILNVTKARIAAGLP
MAGIPFLTTDLTYRCFVSFPLNTGDLDCETCTITRSGLTGLVIGGLYPVFLAIPVNGGLAARYQSALLPH
KGNILSYWIRTSKPVFRKMLFPILLQTMFSAYLGSEQYKLLIKALQLSEPGKEIH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115649
RefSeq Size 818
RefSeq ORF 585
Synonyms OPA7
Locus ID 84233
UniProt ID Q9H061
Cytogenetics 11q14.1
Summary The protein encoded by this gene is a mitochondrial membrane protein of unknown function. Defects in this gene are a cause of optic atrophy type 7 (OPA7). Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Sep 2011
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMEM126A" proteins (3)
SKU Description Size Price
LC410221 Lyophilized TMEM126A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410221 Transient overexpression lysate of transmembrane protein 126A (TMEM126A) (as WB positive control) 100 ug
$436.00
TP303188 Recombinant protein of human transmembrane protein 126A (TMEM126A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products