OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RWDD2A (NM_033411) Human Mass Spec Standard

Be the first to review this product
SKU
PH303103
RWDD2A MS Standard C13 and N15-labeled recombinant protein (NP_219479)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA340213 Rabbit Polyclonal Anti-RWDD2A Antibody
100 ul
$585.00
LY409561 Transient overexpression lysate of RWD domain containing 2A (RWDD2A) (as WB positive control) 100 ug
$436.00

Other products for "RWDD2A or NM_033411"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203103
Predicted MW 33.9 kDa
Protein Sequence
Protein Sequence
>RC203103 protein sequence
Red=Cloning site Green=Tags(s)

MSASVKESLQLQLLEMEMLFSMFPNQGEVKLEDVNALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKI
DLQVTMPHSYPYLALQLFGRSSELDRHQQLLLNKGLTSYIGTFDPGELCVCAAIQWLQDNSASYFLNRKL
VYEPSTQAKPVKNTFLRMWIYSHHIYQQDLRKKILDVGKRLDVTGFCMTGKPGIICVEGFKEHCEEFWHT
IRYPNWKHISCKHAESVETEGNGEDLRLFHSFEELLLEAHGDYGLRNDYHMNLGQFLEFLKKHKSEHVFQ
ILFGIESKSSDS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_219479
RefSeq Size 1432
RefSeq ORF 876
Synonyms dJ747H23.2; RWDD2
Locus ID 112611
UniProt ID Q9UIY3
Cytogenetics 6q14.1
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RWDD2A" proteins (3)
SKU Description Size Price
LC409561 Lyophilized RWDD2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409561 Transient overexpression lysate of RWD domain containing 2A (RWDD2A) (as WB positive control) 100 ug
$436.00
TP303103 Recombinant protein of human RWD domain containing 2A (RWDD2A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products