OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LYRM2 (NM_020466) Human Mass Spec Standard

Be the first to review this product
SKU
PH303091
LYRM2 MS Standard C13 and N15-labeled recombinant protein (NP_065199)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306947 Rabbit Polyclonal LYRM2 Antibody
100 ug
$640.00
LY412437 Transient overexpression lysate of LYR motif containing 2 (LYRM2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "LYRM2 or NM_020466"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203091
Predicted MW 10.4 kDa
Protein Sequence
Protein Sequence
>RC203091 protein sequence
Red=Cloning site Green=Tags(s)

MAASRLPPATLTLKQFVRRQQVLLLYRRILQTIRQVPNDSDRKYLKDWAREEFRRNKSATEEDTIRMMIT
QGNMQLKELEKTLALAKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065199
RefSeq Size 5371
RefSeq ORF 264
Synonyms DJ122O8.2
Locus ID 57226
UniProt ID Q9NU23
Cytogenetics 6q15
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LYRM2" proteins (3)
SKU Description Size Price
LC412437 Lyophilized LYRM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412437 Transient overexpression lysate of LYR motif containing 2 (LYRM2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303091 Recombinant protein of human LYR motif containing 2 (LYRM2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products