PEF1 (NM_012392) Human Mass Spec Standard

CAT#: PH303069

PEF1 MS Standard C13 and N15-labeled recombinant protein (NP_036524)

Product Images

Coomassie blue staining of purified PEF1 protein (Cat# TP303069). The protein was produced from HEK293T cells transfected with PEF1 cDNA clone (Cat# RC203069) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203069
• Predicted MW: 30.4 kDa
• Protein Sequence:
  Sequence Link

  >RC203069 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASYPYRQGCPGAAGQAPGAPPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAGGGPYGHPNPG
  MFPSGTPGGPYGGAAPGGPYGQPPPSSYGAQQPGLYGQGGAPPNVDPEAYSWFQSVDSDHSGYISMKELK
  QALVNCNWSSFNDETCLMMINMFDKTKSGRIDVYGFSALWKFIQQWKNLFQQYDRDRSGSISYTELQQAL
  SQMGYNLSPQFTQLLVSRYCPRSANPAMQLDRFIQVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTA
  SRML
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036524
• RefSeq Size: 1997
• RefSeq ORF: 852
• Synonyms: ABP32; PEF1A
• Locus ID: 553115
• UniProt ID: Q9UBV8, A0A384MQX5
• Cytogenetics: 1p35.2
• Summary: This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. The encoded protein has been shown to form a heterodimer with the programmed cell death 6 gene product and may modulate its function in Ca(2+) signaling. Alternative splicing results in multiple transcript variants and a pseudogene has been identified on chromosome 1.[provided by RefSeq, May 2010]