OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DCPS (NM_014026) Human Mass Spec Standard

Be the first to review this product
SKU
PH303052
DCPS MS Standard C13 and N15-labeled recombinant protein (NP_054745)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505626 DCPS mouse monoclonal antibody,clone OTI4H8 100 ul
$447.00
LY415527 Transient overexpression lysate of decapping enzyme, scavenger (DCPS) (as WB positive control) 100 ug
$436.00

Other products for "DCPS or NM_014026"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203052
Predicted MW 38.7 kDa
Protein Sequence
Protein Sequence
>RC203052 protein sequence
Red=Cloning site Green=Tags(s)

MADAAPQLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNE
ASEDGDGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHL
QKYLRQDLRLIRETGDDYRNITLPHLESQSLSIQWVYNILDKKAEADRIVFENPDPSDGFVLIPDLKWNQ
QQLDDLYLIAICHRRGIRSLRDLTPEHLPLLRNILHQGQEAILQRYRMKGDHLRVYLHYLPSYYHLHVHF
TALGFEAPGSGVERAHLLAEVIENLECDPRHYQQRTLTFALRADDPLLKLLQEAQQS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054745
RefSeq Size 1508
RefSeq ORF 1011
Synonyms ARS; DCS1; HINT-5; HINT5; HSL1; HSPC015
Locus ID 28960
UniProt ID Q96C86
Cytogenetics 11q24.2
Summary This gene encodes a member of the histidine triad family of pyrophosphatases that removes short mRNA fragments containing the 5′ mRNA cap structure, which appear in the 3′ → 5′ mRNA decay pathway, following deadenylation and exosome-mediated turnover. This enzyme hydrolyzes the triphosphate linkage of the cap structure (7-methylguanosine nucleoside triphosphate) to yield 7-methylguanosine monophosphate and nucleoside diphosphate. It protects the cell from the potentially toxic accumulation of these short, capped mRNA fragments, and regulates the activity of other cap-binding proteins, which are inhibited by their accumulation. It also acts as a transcript-specific modulator of pre-mRNA splicing and microRNA turnover. provided by RefSeq, Apr 2017
Protein Pathways RNA degradation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DCPS" proteins (3)
SKU Description Size Price
LC415527 Lyophilized DCPS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415527 Transient overexpression lysate of decapping enzyme, scavenger (DCPS) (as WB positive control) 100 ug
$436.00
TP303052 Recombinant protein of human decapping enzyme, scavenger (DCPS), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products