OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COMMD9 (NM_014186) Human Mass Spec Standard

Be the first to review this product
SKU
PH303050
COMMD9 MS Standard C13 and N15-labeled recombinant protein (NP_054905)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370755 COMMD9 rabbit polyclonal antibody
100 ul
$310.00
LY415448 Transient overexpression lysate of COMM domain containing 9 (COMMD9), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "COMMD9 or NM_014186"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203050
Predicted MW 21.8 kDa
Protein Sequence
Protein Sequence
>RC203050 protein sequence
Red=Cloning site Green=Tags(s)

MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRL
VAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSIS
RMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054905
RefSeq Size 3006
RefSeq ORF 594
Synonyms C11orf55; HSPC166; LINC00610
Locus ID 29099
UniProt ID Q9P000
Cytogenetics 11p13
Summary May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). May down-regulate activation of NF-kappa-B (PubMed:15799966). Modulates Na(+) transport in epithelial cells by regulation of apical cell surface expression of amiloride-sensitive sodium channel (ENaC) subunits (PubMed:23637203).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COMMD9" proteins (5)
SKU Description Size Price
LC415448 Lyophilized COMMD9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420318 Lyophilized COMMD9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415448 Transient overexpression lysate of COMM domain containing 9 (COMMD9), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420318 Transient overexpression lysate of COMM domain containing 9 (COMMD9), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303050 Recombinant protein of human COMM domain containing 9 (COMMD9), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products