OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAP6D1 (NM_024871) Human Mass Spec Standard

Be the first to review this product
SKU
PH302993
MAP6D1 MS Standard C13 and N15-labeled recombinant protein (NP_079147)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA360691 MAP6D1 Antibody - middle region
100 ul
$585.00
LY411035 Transient overexpression lysate of MAP6 domain containing 1 (MAP6D1) (as WB positive control) 100 ug
$436.00

Other products for "MAP6D1 or NM_024871"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202993
Predicted MW 20.8 kDa
Protein Sequence
Protein Sequence
>RC202993 representing NM_024871
Red=Cloning site Green=Tags(s)

MAWPCISRLCCLARRWNQLDRSDVAVPLTLHGYSDLDSEEPGTGGAASRRGQPPAGARDSGRDVPLTQYQ
RDFGLWTTPAGPKDPPPGRGPGAGGRRGKSSAQSSAPPAPGARGVYVLPIGDADAAAAVTTSYRQEFQAW
TGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQVPEVRKKFTPNPSAIFQASAPRILNV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079147
RefSeq Size 2104
RefSeq ORF 597
Synonyms MAPO6D1; SL21
Locus ID 79929
UniProt ID Q9H9H5
Cytogenetics 3q27.1
Summary This gene encodes a protein highly similar to the mouse MAP6 domain containing 1 protein, which is related to the STOP proteins. Based on the study of the mouse protein, the encoded protein may function as a calmodulin-regulated neuronal protein that binds and stabilizes microtubules but also associates with the Golgi membranes through N-terminal palmitoylation. provided by RefSeq, Oct 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MAP6D1" proteins (3)
SKU Description Size Price
LC411035 Lyophilized MAP6D1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411035 Transient overexpression lysate of MAP6 domain containing 1 (MAP6D1) (as WB positive control) 100 ug
$436.00
TP302993 Purified recombinant protein of Homo sapiens MAP6 domain containing 1 (MAP6D1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products