OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OPA3 (NM_025136) Human Mass Spec Standard

Be the first to review this product
SKU
PH302959
OPA3 MS Standard C13 and N15-labeled recombinant protein (NP_079412)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA809426 OPA3 mouse monoclonal antibody,clone OTI3G4 100 ul
$447.00
LY410876 Transient overexpression lysate of optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) (OPA3), nuclear gene encoding mitochondrial protein, transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "OPA3 or NM_025136"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202959
Predicted MW 20 kDa
Protein Sequence
Protein Sequence
>RC202959 protein sequence
Red=Cloning site Green=Tags(s)

MVVGAFPMAKLLYLGIRQVSKPLANRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKP
LNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQV
QAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079412
RefSeq Size 7889
RefSeq ORF 537
Synonyms MGA3
Locus ID 80207
UniProt ID Q9H6K4
Cytogenetics 19q13.32
Summary The mouse ortholog of this protein co-purifies with the mitochondrial inner membrane. Mutations in this gene have been shown to result in 3-methylglutaconic aciduria type III and autosomal dominant optic atrophy and cataract. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Oct 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OPA3" proteins (3)
SKU Description Size Price
LC410876 Lyophilized OPA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410876 Transient overexpression lysate of optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) (OPA3), nuclear gene encoding mitochondrial protein, transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302959 Recombinant protein of human optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) (OPA3), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products