OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MOSPD3 (NM_023948) Human Mass Spec Standard

Be the first to review this product
SKU
PH302908
MOSPD3 MS Standard C13 and N15-labeled recombinant protein (NP_076438)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA335974 Rabbit Polyclonal Anti-MOSPD3 Antibody
100 ul
$525.00
LY411401 Transient overexpression lysate of motile sperm domain containing 3 (MOSPD3), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "MOSPD3 or NM_023948"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202908
Predicted MW 25.5 kDa
Protein Sequence
Protein Sequence
>RC202908 protein sequence
Red=Cloning site Green=Tags(s)

MRRGAPQDQELVGPGPPGRGSRGAPPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVL
CTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAY
PLELQGQPDPAPRPGPPAGTPPPTARHFQEHPRQQLATSSFLLFLLTGIVSVAFLLLPLPDELGSQLPQV
LHVSLGQKLVAAYVLGLLTMVFLRT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076438
RefSeq Size 1213
RefSeq ORF 705
Synonyms CDS3; NET30
Locus ID 64598
UniProt ID O75425
Cytogenetics 7q22.1
Summary This gene encodes a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality. Alternate transcriptional splice variants, encoding different isoforms, have been described. provided by RefSeq, Jul 2008
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MOSPD3" proteins (7)
SKU Description Size Price
LC411401 Lyophilized MOSPD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421670 Lyophilized MOSPD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421671 Lyophilized MOSPD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411401 Transient overexpression lysate of motile sperm domain containing 3 (MOSPD3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421670 Transient overexpression lysate of motile sperm domain containing 3 (MOSPD3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY421671 Transient overexpression lysate of motile sperm domain containing 3 (MOSPD3), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP302908 Recombinant protein of human motile sperm domain containing 3 (MOSPD3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products