OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FOXO3 (NM_201559) Human Mass Spec Standard

Be the first to review this product
SKU
PH302894
FOXO3 MS Standard C13 and N15-labeled recombinant protein (NP_963853)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA809449 FOXO3 mouse monoclonal antibody,clone OTI5F11 100 ul
$447.00
LY400566 Transient overexpression lysate of forkhead box O3 (FOXO3), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "FOXO3 or NM_201559"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202894
Predicted MW 71.1 kDa
Protein Sequence
Protein Sequence
>RC202894 representing NM_201559
Red=Cloning site Green=Tags(s)

MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGG
GRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGA
AGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSI
RHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPES
ADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSS
SASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG
SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSD
PLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLS
ESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRS
ELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_963853
RefSeq Size 3311
RefSeq ORF 2019
Synonyms AF6q21; FKHRL1; FKHRL1P2; FOXO2; FOXO3A
Locus ID 2309
UniProt ID O43524
Cytogenetics 6q21
Summary This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Chemokine signaling pathway, Endometrial cancer, Neurotrophin signaling pathway, Non-small cell lung cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FOXO3" proteins (7)
SKU Description Size Price
PH309846 FOXO3 MS Standard C13 and N15-labeled recombinant protein (NP_001446) 10 ug
$3,360.00
LC400566 Lyophilized FOXO3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404461 Lyophilized FOXO3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400566 Transient overexpression lysate of forkhead box O3 (FOXO3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY404461 Transient overexpression lysate of forkhead box O3 (FOXO3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302894 Recombinant protein of human forkhead box O3 (FOXO3), transcript variant 2, 20 µg 20 ug
$737.00
TP309846 Recombinant protein of human forkhead box O3 (FOXO3), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products