OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TSSC4 (NM_005706) Human Mass Spec Standard

Be the first to review this product
SKU
PH302870
TSSC4 MS Standard C13 and N15-labeled recombinant protein (NP_005697)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA357013 TSSC4 Antibody - N-terminal region
100 ul
$585.00
LY417124 Transient overexpression lysate of tumor suppressing subtransferable candidate 4 (TSSC4) (as WB positive control) 100 ug
$436.00

Other products for "TSSC4 or NM_005706"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202870
Predicted MW 34.3 kDa
Protein Sequence
Protein Sequence
>RC202870 protein sequence
Red=Cloning site Green=Tags(s)

MAEAGTGEPSPSVEGEHGTEYDTLPSDTVSLSDSDSDLSLPGGAEVEALSPMGLPGEEDSGPDEPPSPPS
GLLPATVQPFHLRGMSSTFSQRSRDIFDCLEGAARRAPSSVAHTSMSDNGGFKRPLAPSGRSPVEGLGRA
HRSPASPRVPPVPDYVAHPERWTKYSLEDVTEVSEQSNQATALAFLGSQSLAAPTDCVSSFNQDPSSCGE
GRVIFTKPVRGVEARHERKRVLGKVGEPGRGGLGNPATDRGEGPVELAHLAGPGSPEAEEWGSPHGGLQE
VEALSGSVHSGSVPGLPPVETVGFHGSRKRSRDHFRNKSSSPEDPGAEV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005697
RefSeq Size 1749
RefSeq ORF 987
Locus ID 10078
UniProt ID Q9Y5U2
Cytogenetics 11p15.5
Summary This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene is located among several imprinted genes; however, this gene, as well as the pan-hematopoietic expression gene (PHEMX), escapes imprinting. This gene may play a role in malignancies and disease that involve this region. Several transcript variants encoding two different isoforms have been found for this gene. provided by RefSeq, Jul 2014
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TSSC4" proteins (3)
SKU Description Size Price
LC417124 Lyophilized TSSC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417124 Transient overexpression lysate of tumor suppressing subtransferable candidate 4 (TSSC4) (as WB positive control) 100 ug
$436.00
TP302870 Recombinant protein of human tumor suppressing subtransferable candidate 4 (TSSC4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products