PMVK (NM_006556) Human Mass Spec Standard

CAT#: PH302867

PMVK MS Standard C13 and N15-labeled recombinant protein (NP_006547)

Product Images

Coomassie blue staining of purified PMVK protein (Cat# TP302867). The protein was produced from HEK293T cells transfected with PMVK cDNA clone (Cat# RC202867) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202867
• Predicted MW: 22 kDa
• Protein Sequence:
  Sequence Link

  >RC202867 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKE
  AFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQ
  RGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006547
• RefSeq Size: 1307
• RefSeq ORF: 576
• Synonyms: HUMPMKI; PMK; PMKA; PMKASE; POROK1
• Locus ID: 10654
• UniProt ID: Q15126, Q6FGV9
• Cytogenetics: 1q21.3
• Summary: This gene encodes a peroxisomal enzyme that is a member of the galactokinase, homoserine kinase, mevalonate kinase, and phosphomevalonate kinase (GHMP) family of ATP-dependent enzymes. The encoded protein catalyzes the conversion of mevalonate 5-phosphate to mevalonate 5-diphosphate, which is the fifth step in the mevalonate pathway of isoprenoid biosynthesis. Mutations in this gene are linked to certain types of porokeratosis including disseminated superficial porokeratosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2017]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Terpenoid backbone biosynthesis