OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ASB3 (NM_145863) Human Mass Spec Standard

Be the first to review this product
SKU
PH302814
ASB3 MS Standard C13 and N15-labeled recombinant protein (NP_665862)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349688 Rabbit Polyclonal Anti-ASB3 Antibody
100 ul
$205.00
LY402502 Transient overexpression lysate of ankyrin repeat and SOCS box-containing 3 (ASB3), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "ASB3 or NM_145863"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202814
Predicted MW 57.7 kDa
Protein Sequence
Protein Sequence
>RC202814 protein sequence
Red=Cloning site Green=Tags(s)

MDFTEAYADTCSTVGLAAREGNVKVLRKLLKKGRSVDVADNRGWMPIHEAAYHNSVECLQMLINADSSEN
YIKMKTFEGFCALHLAASQGHWKIVQILLEAGADPNATTLEETTPLFLAVENGQIDVLRLLLQHGANVNG
SHSMCGWNSLHQASFQENAEIIKLLLRKGANKECQDDFGITPLFVAAQYGKLESLSILISSGANVNCQAL
DKATPLFIAAQEGHTKCVELLLSSGADPDLYCNEDSWQLPIHAAAQMGHTKILDLLIPLTNRACDTGLNK
VSPVYSAVFGGHEDCLEILLRNGYSPDAQACLVFGFSSPVCMAFQKDCEFFGIVNILLKYGAQINELHLA
YCLKYEKFSIFRYFLRKGCSLGPWNHIYEFVNHAIKAQAKYKEWLPHLLVAGFDPLILLCNSWIDSVSID
TLIFTLEFTNWKTLAPAVERMLSARASNAWILQQHIATVPSLTHLCRLEIRSSLKSERLRSDSYISQLPL
PRSLHNYLLYEDVLRMYEVPELAAIQDG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_665862
RefSeq Size 2081
RefSeq ORF 1554
Synonyms ASB-3
Locus ID 51130
UniProt ID Q9Y575
Cytogenetics 2p16.2
Summary The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Alternatively spliced transcript variants have been described for this gene. provided by RefSeq, Jan 2011
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ASB3" proteins (7)
SKU Description Size Price
PH316743 ASB3 MS Standard C13 and N15-labeled recombinant protein (NP_057199) 10 ug
$3,360.00
LC402502 Lyophilized ASB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407847 Lyophilized ASB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402502 Transient overexpression lysate of ankyrin repeat and SOCS box-containing 3 (ASB3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY407847 Transient overexpression lysate of ankyrin repeat and SOCS box-containing 3 (ASB3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302814 Recombinant protein of human ankyrin repeat and SOCS box-containing 3 (ASB3), transcript variant 2, 20 µg 20 ug
$867.00
TP316743 Recombinant protein of human ankyrin repeat and SOCS box-containing 3 (ASB3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products