ASB3 (NM_016115) Human Mass Spec Standard

SKU
PH316743
ASB3 MS Standard C13 and N15-labeled recombinant protein (NP_057199)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216743]
Predicted MW 57.6 kDa
Protein Sequence
Protein Sequence
>RC216743 representing NM_016115
Red=Cloning site Green=Tags(s)

MDFTEAYADTCSTVGLAAREGNVKVLRKLLKKGRSVDVADNRGWMPIHEAAYHNSVECLQMLINADSSEN
YIKMKTFEGFCALHLAASQGHWKIVQILLEAGADPNATTLEETTPLFLAVENGQIDVLRLLLQHGANVNG
SHSMCGWNSLHQASFQENAEIIKLLLRKGANKECQDDFGITPLFVAAQYGKLESLSILISSGANVNCQAL
DKATPLFIAAQEGHTKCVELLLSSGADPDLYCNEDSWQLPIHAAAQMGHTKILDLLIPLTNRACDTGLNK
VSPVYSAVFGGHEDCLEILLRNGYSPDAQACLVFGFSSPVCMAFQKDCEFFGIVNILLKYGAQINELHLA
YCLKYEKFSIFRYFLRKGCSLGPWNHIYEFVNHAIKAQAKYKEWLPHLLVAGFDPLILLCNSWIDSVSID
TLIFTLEFTNWKTLAPAVERMLSARASNAWILQQHIATVPSLTHLCRLEIRSSLKSERLRSDSYISQLPL
PRSLHNYLLYEDVLRMYEVPELAAIQDG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057199
RefSeq Size 2214
RefSeq ORF 1554
Synonyms ASB-3
Locus ID 51130
UniProt ID Q9Y575
Cytogenetics 2p16.2
Summary The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jan 2011]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:ASB3 (NM_016115) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH302814 ASB3 MS Standard C13 and N15-labeled recombinant protein (NP_665862) 10 ug
$3,255.00
LC402502 ASB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407847 ASB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402502 Transient overexpression lysate of ankyrin repeat and SOCS box-containing 3 (ASB3), transcript variant 1 100 ug
$436.00
LY407847 Transient overexpression lysate of ankyrin repeat and SOCS box-containing 3 (ASB3), transcript variant 2 100 ug
$436.00
TP302814 Recombinant protein of human ankyrin repeat and SOCS box-containing 3 (ASB3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP316743 Recombinant protein of human ankyrin repeat and SOCS box-containing 3 (ASB3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.