OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CXCL5 (NM_002994) Human Mass Spec Standard

Be the first to review this product
SKU
PH302707
CXCL5 MS Standard C13 and N15-labeled recombinant protein (NP_002985)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA367666 CXCL5 rabbit polyclonal antibody
100 ul
$310.00
LY401049 Transient overexpression lysate of chemokine (C-X-C motif) ligand 5 (CXCL5) (as WB positive control) 100 ug
$436.00

Other products for "CXCL5 or NM_002994"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202707
Predicted MW 12 kDa
Protein Sequence
Protein Sequence
>RC202707 protein sequence
Red=Cloning site Green=Tags(s)

MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFA
IGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002985
RefSeq Size 2505
RefSeq ORF 342
Synonyms ENA-78; SCYB5
Locus ID 6374
UniProt ID P42830
Cytogenetics 4q13.3
Summary This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion. provided by RefSeq, May 2013
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CXCL5" proteins (7)
SKU Description Size Price
LC401049 Lyophilized CXCL5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401049 Transient overexpression lysate of chemokine (C-X-C motif) ligand 5 (CXCL5) (as WB positive control) 100 ug
$436.00
TP302707 Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), 20 µg 20 ug
$867.00
TP700192 Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R45K mutant, 20 ug 20 ug
$900.00
TP700193 Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R48K mutant, 20 ug 20 ug
$900.00
TP700194 Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R45K and R48K double mutant, 20 ug 20 ug
$900.00
TP720876 Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5) 10 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products