OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

METTL7A (NM_014033) Human Mass Spec Standard

Be the first to review this product
SKU
PH302601
METTL7A MS Standard C13 and N15-labeled recombinant protein (NP_054752)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA809878 METTL7A mouse monoclonal antibody,clone OTI4B10 100 ul
$447.00
LY415471 Transient overexpression lysate of methyltransferase like 7A (METTL7A) (as WB positive control) 100 ug
$436.00

Other products for "METTL7A or NM_014033"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202601
Predicted MW 28.3 kDa
Protein Sequence
Protein Sequence
>RC202601 protein sequence
Red=Cloning site Green=Tags(s)

MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSG
KLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDV
VVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWK
ALERASFSKLKLQHIQAPLSWELVRPHIYGYAVK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054752
RefSeq Size 3390
RefSeq ORF 732
Synonyms AAM-B; AAMB
Locus ID 25840
UniProt ID Q9H8H3
Cytogenetics 12q13.12
Summary Probable methyltransferase.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "METTL7A" proteins (3)
SKU Description Size Price
LC415471 Lyophilized METTL7A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415471 Transient overexpression lysate of methyltransferase like 7A (METTL7A) (as WB positive control) 100 ug
$436.00
TP302601 Recombinant protein of human methyltransferase like 7A (METTL7A), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products