METTL7A (NM_014033) Human Recombinant Protein

SKU
TP302601
Recombinant protein of human methyltransferase like 7A (METTL7A), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202601 protein sequence
Red=Cloning site Green=Tags(s)

MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSG
KLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDV
VVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWK
ALERASFSKLKLQHIQAPLSWELVRPHIYGYAVK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 28.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_054752
Locus ID 25840
UniProt ID Q9H8H3
Cytogenetics 12q13.12
RefSeq Size 3390
RefSeq ORF 732
Synonyms AAM-B; AAMB
Summary Probable methyltransferase.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:METTL7A (NM_014033) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302601 METTL7A MS Standard C13 and N15-labeled recombinant protein (NP_054752) 10 ug
$3,255.00
LC415471 METTL7A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415471 Transient overexpression lysate of methyltransferase like 7A (METTL7A) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.