OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EPB41L1 (NM_177996) Human Mass Spec Standard

Be the first to review this product
SKU
PH302596
EPB41L1 MS Standard C13 and N15-labeled recombinant protein (NP_818932)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY403596 Transient overexpression lysate of erythrocyte membrane protein band 4.1-like 1 (EPB41L1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "EPB41L1 or NM_177996"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202596
Predicted MW 87.6 kDa
Protein Sequence
Protein Sequence
>RC202596 protein sequence
Red=Cloning site Green=Tags(s)

MEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNL
LEKDYFGLTFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIIT
GRLPCSFVTHALLGSYAVQAELGDYDAEEHVGNYVSELRFAPNQTRELEERIMELHKTYRGMTPGEAEIH
FLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGE
YEQFESTIGFKLPNHRSAKRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDR
PAPFFERSSSKRYTMSRSLDGAEFSRPASVSENHDAGPDGDKRDEDGESGGQRSEAEEGEVRTPTKIKEL
KFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWERERRLPSSPASPSPKGTPEKANERAGLREGS
EEKVKPPRPRAPESDTGDEDQDQERDTVFLKDNHLAIERKCSSITVSSTSSLEAEVDFTVIGDYHGSAFE
DFSRSLPELDRDKSDSDTEGLLFSRDLNKGAPSQDDESGGIEDSPDRGACSTPDMPQFEPVKTETMTVSS
LAIRKKIEPEAVLQTRVSAMDNTQENSLKSGKGAAAMIPGPQTVATEIRSLSPIIGKDVLTSTYGATAET
LSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQALALAIKEAKLQHPDMLVTKAVVYRETDPSPE
ERDKKPQES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_818932
RefSeq Size 5967
RefSeq ORF 2337
Synonyms 4.1N; MRD11
Locus ID 2036
UniProt ID Q9H4G0
Cytogenetics 20q11.23
Summary Erythrocyte membrane protein band 4.1 (EPB41) is a multifunctional protein that mediates interactions between the erythrocyte cytoskeleton and the overlying plasma membrane. The encoded protein binds and stabilizes D2 and D3 dopamine receptors at the neuronal plasma membrane. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jan 2015
Protein Families Druggable Genome
Protein Pathways Tight junction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EPB41L1" proteins (7)
SKU Description Size Price
PH306660 EPB41L1 MS Standard C13 and N15-labeled recombinant protein (NP_036288) 10 ug
$3,360.00
LC403596 Lyophilized EPB41L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415924 Lyophilized EPB41L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403596 Transient overexpression lysate of erythrocyte membrane protein band 4.1-like 1 (EPB41L1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY415924 Transient overexpression lysate of erythrocyte membrane protein band 4.1-like 1 (EPB41L1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302596 Recombinant protein of human erythrocyte membrane protein band 4.1-like 1 (EPB41L1), transcript variant 2, 20 µg 20 ug
$867.00
TP306660 Recombinant protein of human erythrocyte membrane protein band 4.1-like 1 (EPB41L1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products