EPB41L1 (NM_177996) Human Recombinant Protein

SKU
TP302596
Recombinant protein of human erythrocyte membrane protein band 4.1-like 1 (EPB41L1), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202596 protein sequence
Red=Cloning site Green=Tags(s)

MEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNL
LEKDYFGLTFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIIT
GRLPCSFVTHALLGSYAVQAELGDYDAEEHVGNYVSELRFAPNQTRELEERIMELHKTYRGMTPGEAEIH
FLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGE
YEQFESTIGFKLPNHRSAKRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDR
PAPFFERSSSKRYTMSRSLDGAEFSRPASVSENHDAGPDGDKRDEDGESGGQRSEAEEGEVRTPTKIKEL
KFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWERERRLPSSPASPSPKGTPEKANERAGLREGS
EEKVKPPRPRAPESDTGDEDQDQERDTVFLKDNHLAIERKCSSITVSSTSSLEAEVDFTVIGDYHGSAFE
DFSRSLPELDRDKSDSDTEGLLFSRDLNKGAPSQDDESGGIEDSPDRGACSTPDMPQFEPVKTETMTVSS
LAIRKKIEPEAVLQTRVSAMDNTQENSLKSGKGAAAMIPGPQTVATEIRSLSPIIGKDVLTSTYGATAET
LSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQALALAIKEAKLQHPDMLVTKAVVYRETDPSPE
ERDKKPQES

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 87.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_818932
Locus ID 2036
UniProt ID Q9H4G0
Cytogenetics 20q11.23
RefSeq Size 5967
RefSeq ORF 2337
Synonyms 4.1N; MRD11
Summary Erythrocyte membrane protein band 4.1 (EPB41) is a multifunctional protein that mediates interactions between the erythrocyte cytoskeleton and the overlying plasma membrane. The encoded protein binds and stabilizes D2 and D3 dopamine receptors at the neuronal plasma membrane. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2015]
Protein Families Druggable Genome
Protein Pathways Tight junction
Write Your Own Review
You're reviewing:EPB41L1 (NM_177996) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302596 EPB41L1 MS Standard C13 and N15-labeled recombinant protein (NP_818932) 10 ug
$3,255.00
PH306660 EPB41L1 MS Standard C13 and N15-labeled recombinant protein (NP_036288) 10 ug
$3,255.00
LC403596 EPB41L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415924 EPB41L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403596 Transient overexpression lysate of erythrocyte membrane protein band 4.1-like 1 (EPB41L1), transcript variant 2 100 ug
$436.00
LY415924 Transient overexpression lysate of erythrocyte membrane protein band 4.1-like 1 (EPB41L1), transcript variant 1 100 ug
$436.00
TP306660 Recombinant protein of human erythrocyte membrane protein band 4.1-like 1 (EPB41L1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.