OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ALKBH7 (NM_032306) Human Mass Spec Standard

Be the first to review this product
SKU
PH302583
ALKBH7 MS Standard C13 and N15-labeled recombinant protein (NP_115682)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA373465 ALKBH7 Rabbit polyclonal Antibody
100 ul
$410.00
LY403154 Transient overexpression lysate of alkB, alkylation repair homolog 7 (E. coli) (ALKBH7) (as WB positive control) 100 ug
$436.00

Other products for "ALKBH7 or NM_032306"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202583
Predicted MW 24.5 kDa
Protein Sequence
Protein Sequence
>RC202583 protein sequence
Red=Cloning site Green=Tags(s)

MAGTGLLALRTLPGPSWVRGSGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRRYEYDHWDAAI
HGFRETEKSRWSEASRAILQRVQAAAFGPGQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSP
SVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGERRIPRGRRISVICRSLPEGMG
PGESGQPPPAC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115682
RefSeq Size 1331
RefSeq ORF 663
Synonyms ABH7; SPATA11; UNQ6002
Locus ID 84266
UniProt ID Q9BT30
Cytogenetics 19p13.3
Summary May function as protein hydroxylase; can catalyze auto-hydroxylation at Leu-110 (in vitro), but this activity may be due to the absence of the true substrate (PubMed:25122757). Required to induce programmed necrosis in response to DNA damage caused by cytotoxic alkylating agents. Acts by triggering the collapse of mitochondrial membrane potential and loss of mitochondrial function that leads to energy depletion and cell death (PubMed:23666923). ALKBH7-mediated necrosis is probably required to prevent the accumulation of cells with DNA damage (PubMed:23666923). Does not display DNA demethylase activity (PubMed:23666923). Involved in fatty acid metabolism (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ALKBH7" proteins (3)
SKU Description Size Price
LC403154 Lyophilized ALKBH7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403154 Transient overexpression lysate of alkB, alkylation repair homolog 7 (E. coli) (ALKBH7) (as WB positive control) 100 ug
$436.00
TP302583 Recombinant protein of human alkB, alkylation repair homolog 7 (E. coli) (ALKBH7), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products