OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZSCAN16 (NM_025231) Human Mass Spec Standard

Be the first to review this product
SKU
PH302518
ZSCAN16 MS Standard C13 and N15-labeled recombinant protein (NP_079507)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA315831 Rabbit polyclonal anti-ZNF435 antibody
100 ul
$380.00
LY410777 Transient overexpression lysate of zinc finger and SCAN domain containing 16 (ZSCAN16) (as WB positive control) 100 ug
$436.00

Other products for "ZSCAN16 or NM_025231"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202518
Predicted MW 40.8 kDa
Protein Sequence
Protein Sequence
>RC202518 protein sequence
Red=Cloning site Green=Tags(s)

MTTALEPEDQKGLLIIKAEDHYWGQDSSSQKCSPHRRELYRQHFRKLCYQDAPGPREALTQLWELCRQWL
RPECHTKEQILDLLVLEQFLSILPKDLQAWVRAHHPETGEEAVTVLEDLERELDEPGKQVPGNSERRDIL
MDKLAPLGRPYESLTVQLHPKKTQLEQEAGKPQRNGDKTRTKNEELFQKEDMPKDKEFLGEINDRLNKDT
PQHPKSKDIIENEGRSEWQQRERRRYKCDECGKSFSHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLI
GHHRVHTGVKPYKCKECGKDFSGRTGLIQHQRIHTGEKPYECDECGRPFRVSSALIRHQRIHTANKLY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079507
RefSeq Size 1290
RefSeq ORF 1044
Synonyms dJ265C24.3; ZNF392; ZNF435
Locus ID 80345
UniProt ID Q9H4T2
Cytogenetics 6p22.1
Summary May be involved in transcriptional regulation.UniProtKB/Swiss-Prot Function
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ZSCAN16" proteins (3)
SKU Description Size Price
LC410777 Lyophilized ZSCAN16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410777 Transient overexpression lysate of zinc finger and SCAN domain containing 16 (ZSCAN16) (as WB positive control) 100 ug
$436.00
TP302518 Recombinant protein of human zinc finger and SCAN domain containing 16 (ZSCAN16), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products